Beta -Amyloid ( 1-42), rat

Origin
N/A
Minimum Order
N/A
Inspection
N/A
Packing
N/A
Delivery
N/A
Payment
N/A
Keywords

In this December, there are two kinds of hot products (>95% purity) in unbelievable price as below.

1.      β –Amyloid ( 142), rat

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

        1mg ( USD 109 )   5mg ( USD 311 )

2.      VIP , human , porcine, rat, ovine

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2                

        1mg ( USD 78 )   5mg ( USD 156 )

If any product meets your demand, please contact me. I am sure any your question will get our prompt reply with kindest regards.

My email address: cps044 (AT) chinapeptides.net

Business Scope

Peptide Synthesis, Protein Expression, Custom Antibody, Gene Synthesis Service, Primer Synthesis, HPLC Purification, MS Detect, DNA Sequencing, and so on.


Other supplies related products

beta-Amyloid(1-42),Human

Payment:T/T
Delivery:Express delivery
Origin:Shanghai
Packing:white powder
PEPTIDE

Shanghai Top-peptide Biotechnology Co.,ltd.

China China
Exporter, Service
86-021-1522102552

beta-amyloid(1-42)

Payment:TT
Delivery:10days
Origin:Shanghai
Packing:vial
Beta-Amyloid(1-42)

GINGI INDUSTRIAL LIMITED

China China
Manufacturer
86-21-5269-1646

ChinaPeptides Co., Ltd.

China China
Contact Person: Lin Jin
Telephone: +86 512 6393 0660
Location: Jiangsu, China
Fax:+86 512 6300 9934
Business Type:Manufacturer, Wholesaler/Retailer, Others
Main Target Region:World Wide
Address:
F4, 8 Pangyang Road, Wujiang
Main Product:
synthetic peptide; custom antibody; protein expression
View the Seller's Store

Products from the company